PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07034g07006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 382aa    MW: 41819.4 Da    PI: 6.3751
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07034g07006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.91.4e-18303337135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  Niben101Scf07034g07006.1 303 CSHCGVQKTPQWRAGPMGAKTLCNACGVRFKSGRL 337
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.78297333IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-16297351IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-14299360No hitNo description
Gene3DG3DSA:3.30.50.107.1E-15301335IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.66E-14302350No hitNo description
PfamPF003201.7E-16303337IPR000679Zinc finger, GATA-type
PROSITE patternPS003440303328IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MLYRTQHHSF FSPFTFSSSL SPHPLPQPSS SPSPLSHLPS DQGMDCVEGA LKSSFMSEAA  60
LKTTHQQAYG DDLWANGNGQ NVVSGDDFFV DDLLDFSNGF VEDQGEEEKG EDNAVHKICS  120
VSVSVSPQKQ LEDKEAEKEN DNISPPAKED FDSLPGSELI VPADDLDSLE WLSHFVEDSF  180
SEYSLTYPAG KLPVKPVVNQ SEDGEIPFQE KSCFITPVQT KARTKRGRTN VRVWPAGSGS  240
LTESASSSSS SSSTTTMSSS PSNWVLYQIP VHTAESPGKP PAKKPKRKPA VHGGNGPQQP  300
RRCSHCGVQK TPQWRAGPMG AKTLCNACGV RFKSGRLLPE YRPACSPTFS TELHSNNHRK  360
VLEMRRKKEF EESGSARPVQ SF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761911.10.0PREDICTED: GATA transcription factor 5
RefseqXP_016446822.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH571e-75GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0V0I2Z31e-150A0A0V0I2Z3_SOLCH; Putative GATA transcription factor 5-like
STRINGPGSC0003DMT4000091181e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-69GATA transcription factor 5